Protein Info for Echvi_3476 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA uptake lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 996 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13174: TPR_6" amino acids 140 to 161 (22 residues), 12.6 bits, see alignment (E = 0.0001) amino acids 353 to 384 (32 residues), 15.7 bits, see alignment (E = 1.1e-05) amino acids 431 to 452 (22 residues), 12.5 bits, see alignment (E = 0.00012) amino acids 580 to 612 (33 residues), 16 bits, see alignment (E = 8.4e-06) amino acids 655 to 685 (31 residues), 13.3 bits, see alignment (E = 6.1e-05) amino acids 731 to 760 (30 residues), 16.1 bits, see alignment (E = 7.9e-06) PF13181: TPR_8" amino acids 246 to 272 (27 residues), 12.3 bits, see alignment (E = 9.2e-05) PF13432: TPR_16" amino acids 248 to 306 (59 residues), 16.9 bits, see alignment 4.1e-06 amino acids 321 to 386 (66 residues), 23.3 bits, see alignment 3.9e-08 amino acids 433 to 489 (57 residues), 17.1 bits, see alignment 3.4e-06 amino acids 731 to 792 (62 residues), 21.2 bits, see alignment 1.8e-07

Best Hits

KEGG orthology group: None (inferred from 34% identity to lby:Lbys_0932)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2D3 at UniProt or InterPro

Protein Sequence (996 amino acids)

>Echvi_3476 DNA uptake lipoprotein (Echinicola vietnamensis KMM 6221, DSM 17526)
MRKLLLLFVATGIFCQAQGQSSLYQTGLERQIDDAYELFDKHQYSASKLEFEKLKEASLS
PSQQIDVDFYHAVSALRLDNPDGPSLVAKIIMDYPNDPKANEAAFLMGDYYFDKRHYKKS
IEAYNLVNVDVVTFEQRSKVYFKTGYAYFQLKDYANAARYFDPVKKMQTSYTGDGYYYGG
YVALEQNKYDQAIADFKQADRYPEYQSKVPYMLSELYYRQEQYDELIAYATPITQSRGNL
DRKEGIYLLLAEAYFEKRDFTNAATYYDAATKAGKGDMTREQMYKAGVAQFKVNQYEKAT
DYFKQVALEKDKLGQVSSYYLGHAYLQLNNPQYAVTSFSTAYKSDYDPAIKEEALFNYAK
LSLERGGFQEAINALDSYLANYPNGPHVGEVETLLSDALINTNNYLRAIQHIEGMSNRSP
AIRAAYQKVTYYQGLTYYRNKQYNQAITYFDKSITYPVDKEIVHEAFYRKGEAFAAKEDL
KGAITAYEQVMNMRLTSLDPALIKSHYGLGYAYFNTQEYAKAERQFKSYTDKIKKVSNVQ
SYYDDALIRLGDCYYIQKKFDPALSTFHLAISERNPSSDYAHYMAGVVLNFQNRNREAVA
ELDRAISQYPNSRFRDDIIFQKAQINMEESNYAAAREGYSNLINKSPNSPFVPYALEGRA
IASYSLKNYDQTINDYKKILDRYPNADNANAALVGLQEALTLQGRSGEFSNYLSDYKNSN
PGNESVQGVEYEAAKNLFFGQSYQQAIRAFQTYLSNYPNSAQKQEATYFIGDAYLRLEQE
EKALETFYQLEKMGASSQRAKAIQRIAEIEFNRKNYQQAIPYFITSTKVARDRIEQYEAN
KGLMMAYYETGKYDSADFYANKVIELGDVTADAKSNAQLIKAKSLLKTGKNADAQDELMA
LVNESGSIQGAEALFLLAESFRKAENFSQSNETIFSFSEKYAVYDYWYGKCFVLLAKNYK
SLNENFQAKATLESVIENSANDQVIKEAKAELSTLP