Protein Info for Echvi_3473 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF13432: TPR_16" amino acids 5 to 67 (63 residues), 31.2 bits, see alignment E=1.4e-10 amino acids 46 to 102 (57 residues), 17.3 bits, see alignment E=3e-06 PF13174: TPR_6" amino acids 6 to 32 (27 residues), 14.7 bits, see alignment (E = 2.2e-05) PF13181: TPR_8" amino acids 75 to 101 (27 residues), 12.3 bits, see alignment (E = 9.2e-05) amino acids 110 to 135 (26 residues), 19.7 bits, see alignment (E = 3.9e-07) amino acids 138 to 165 (28 residues), 14.2 bits, see alignment (E = 2.3e-05) PF13414: TPR_11" amino acids 116 to 150 (35 residues), 31.1 bits, see alignment 8.5e-11 PF13431: TPR_17" amino acids 125 to 150 (26 residues), 22 bits, see alignment (E = 7.7e-08)

Best Hits

KEGG orthology group: None (inferred from 33% identity to mtt:Ftrac_0204)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0H2 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Echvi_3473 Tetratricopeptide repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDINQGISLYKEGKFEEALEVFNQLLANTPNQPIILLHRGRVLSRMGKLELALEDFDLL
LKTDQYNADFISDRAVVLHLLKRNEEALSELDRALNLDPNNPYRYSSRAFLKDRIGDLEG
AIADYEKAIEMDPEDAVSYNNKGIVEEKLGYKERSKKSFDKADKLVGYQPKEYKSTNAPK
ENPVKKTPDQIPEQLKNQPTPQTKSLSFTNYWKTVGKVLSDKNTRAEFFSFIQSKLGKKK