Protein Info for Echvi_3443 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Domain of Unknown Function (DUF349).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 PF03993: DUF349" amino acids 132 to 198 (67 residues), 49.9 bits, see alignment E=1.6e-17 amino acids 205 to 277 (73 residues), 78.2 bits, see alignment E=2.5e-26 amino acids 281 to 359 (79 residues), 75.3 bits, see alignment E=1.9e-25 amino acids 364 to 436 (73 residues), 63.4 bits, see alignment E=1e-21 amino acids 441 to 511 (71 residues), 70.5 bits, see alignment E=6e-24

Best Hits

KEGG orthology group: None (inferred from 52% identity to mtt:Ftrac_0223)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3U0 at UniProt or InterPro

Protein Sequence (625 amino acids)

>Echvi_3443 Domain of Unknown Function (DUF349). (Echinicola vietnamensis KMM 6221, DSM 17526)
MENDKEISEENKVTQEQVENTDAGNQHEPKNESSQRVEEHHDEEHHDQEEHHEEEHHVDY
GNFSKKQLLSALKELLEKGKYIQDDHVANDIKTHYEEDHFNKEKEEALKSFVQEGGTEDD
FFYKQSEDDKMFFALYGEYKNRRSSQIKELEETKEKNLFAKNQILERLRELVDGEETTHS
ISTIKEIQQEWKDIGPVPGAQNKNLWASYNALMDRFYDNRSIYFELKELDRKKNLEGKLE
LCEKAEALDKEEDLRTAIRALNELHEEFKHIGPVPREEQEAVWQRFKAASDAIYAKRKAY
YESQKEVFKENQTKKEALIQKLDDFKDFKANRIKEWNSKTKEILAIQKEWEAIGPVPREC
GREINRGFWGAFKQFFHNKNLFFKELDEIRRINKEKAEELIKVAEELKDSTDWQNTSNAL
IKLQQDWKKLGPTPEKVRDDLYKRFKTACDTFFDNRREANKEINKEFDKNLELKEEVCEK
IKALPEGEEFTVENLEKLVAEYNSIGFVPRKNIKEIAGKFNQAVEACVEKLDTDGENREE
FLFRLNLNKIQGDPNSDRVFNKKEHGIRKQIADLENNITLWKNNLEFFASSKTADKLKNQ
FDEKIEKAEEEIDKLKKKLSILREF