Protein Info for Echvi_3438 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: thioredoxin-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR01292: thioredoxin-disulfide reductase" amino acids 9 to 308 (300 residues), 402.9 bits, see alignment E=3.1e-125 PF07992: Pyr_redox_2" amino acids 9 to 297 (289 residues), 170.2 bits, see alignment E=2.4e-53 PF00890: FAD_binding_2" amino acids 10 to 46 (37 residues), 23.8 bits, see alignment 8.8e-09 PF13738: Pyr_redox_3" amino acids 66 to 280 (215 residues), 61.5 bits, see alignment E=2.9e-20 PF00070: Pyr_redox" amino acids 150 to 222 (73 residues), 61.1 bits, see alignment E=4.4e-20

Best Hits

Swiss-Prot: 56% identical to TRXB_RICBR: Thioredoxin reductase (trxB) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 78% identity to mtt:Ftrac_0217)

MetaCyc: 52% identical to thioredoxin reductase (Escherichia coli K-12 substr. MG1655)
Thioredoxin-disulfide reductase. [EC: 1.8.1.9]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3T6 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Echvi_3438 thioredoxin-disulfide reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKEAEKIKVLIVGSGPAGYTAAIYASRAGLSPVLYTGGQPGGQLTITNDVENYPGYPDG
VMGPQMMEDFKKQAERFGTDVRYGLVTAVDFSTGPHKVIVDDKDEILADTVIISTGASAK
WLGLESETKLNGKGVSACAVCDGFFFRNQKVAIVGAGDTACEEASYLANICEKVYMLVRR
DEMRASQIMQKRVTSNPKIEILWNTETEEILGEEEVTGVRVKNNQTGEEQELEVTGFFVA
IGHKPNTDIFKDFLDMNEAGYINTQPGSTKTNIEGVFACGDAQDHVYRQAVTAAGTGCMS
ALDAERFLAEKELA