Protein Info for Echvi_3437 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00140: Sigma70_r1_2" amino acids 17 to 49 (33 residues), 57.1 bits, see alignment 2.9e-19 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 50 to 275 (226 residues), 120.5 bits, see alignment E=2.9e-39 PF04542: Sigma70_r2" amino acids 56 to 123 (68 residues), 66.2 bits, see alignment E=3.8e-22 PF04539: Sigma70_r3" amino acids 135 to 208 (74 residues), 55 bits, see alignment E=1.4e-18 PF04545: Sigma70_r4" amino acids 222 to 275 (54 residues), 66.5 bits, see alignment E=2.4e-22

Best Hits

Swiss-Prot: 42% identical to RPOS_SALT1: RNA polymerase sigma factor RpoS (rpoS) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: K03086, RNA polymerase primary sigma factor (inferred from 94% identity to sli:Slin_1987)

MetaCyc: 42% identical to RNA polymerase sigma factor RpoS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoD" in subsystem Flagellum or Macromolecular synthesis operon or Transcription factors cyanobacterial RpoD-like sigma factors or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4A4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Echvi_3437 RNA polymerase sigma factor, sigma-70 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MRQLKISKQITNRESQSLDKYLQEIGKVDLLTADEEVVLAKRIREGDQLALEKLTKANLR
FVVSVAKQYQNQGLSLGDLINEGNLGLIKAAQRFDETRGFKFISYAVWWIRQSILQALAE
QSRIVRLPLNRVGSLNKISKTFSELEQRFEREPSPEELAEVLEVTAGEVVDTMKISGRHV
SMDAPFVQGEENSLLDVLENDGEEKPDDGLMNDSLRKEVQRALSTLTQREADVITLYFGL
NGEHAMTLEEIGEKFNLTRERVRQIKEKAIRRLRHTSRSKTLKPYLG