Protein Info for Echvi_3435 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosomal protein S15, bacterial/organelle

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 TIGR00952: ribosomal protein uS15" amino acids 4 to 91 (88 residues), 112.3 bits, see alignment E=5.2e-37 PF00312: Ribosomal_S15" amino acids 12 to 90 (79 residues), 109 bits, see alignment E=5.2e-36

Best Hits

Swiss-Prot: 72% identical to RS15_CYTH3: 30S ribosomal protein S15 (rpsO) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02956, small subunit ribosomal protein S15 (inferred from 79% identity to mtt:Ftrac_0214)

Predicted SEED Role

"SSU ribosomal protein S15p (S13e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2X2 at UniProt or InterPro

Protein Sequence (91 amino acids)

>Echvi_3435 ribosomal protein S15, bacterial/organelle (Echinicola vietnamensis KMM 6221, DSM 17526)
MYLTTEKKEELFKNHGRLKSEKDTGSPESQIALFTYRIKHLTDHLKSNKKDHSTRLGLLK
LVGKRRSLLNYLYKNDIERYRAIIADLGLRK