Protein Info for Echvi_3409 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF00512: HisKA" amino acids 14 to 77 (64 residues), 56.8 bits, see alignment E=2.8e-19 PF02518: HATPase_c" amino acids 125 to 239 (115 residues), 78.2 bits, see alignment E=9.9e-26 PF00072: Response_reg" amino acids 264 to 369 (106 residues), 66.7 bits, see alignment E=2.9e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0C7 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Echvi_3409 Signal transduction histidine kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKEDFNSKKNTDKLKLLSLVSHEIRTPLHGIIGLTEQLQDTALSADQKSLVDHLIHTER
ILMNLINDVLDYSKLKSAAFDIKLKAASLPTILHELKVLFAPLANQKSLDLDVSINVESG
HVLVDILRLKQVLSNLINNALKFTHTGYIRLECQQLPSQNDQENPTYRFTVEDTGAGIPE
GEEDSIFEAYGQSSENNNHNGTGLGLTISNMILHNMGSELKLSKPRPAGKGAIFYFDLVL
APTDETPVHQKKQLTHQFGGKSALLVDDDPLIQKITAGMLEKEAIAVKISSSFNSALNHL
QEVHPDLIFIDLVLGETDGADLLKYLKEKEKHPGAFVCMTASENSKDEILRMGFDAVLRK
PFNRRALARVLSQLSQ