Protein Info for Echvi_3406 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 786 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 24 to 99 (76 residues), 53.2 bits, see alignment E=6.4e-18 PF13715: CarbopepD_reg_2" amino acids 25 to 111 (87 residues), 65.4 bits, see alignment E=8.1e-22 PF07715: Plug" amino acids 133 to 232 (100 residues), 42.4 bits, see alignment E=1.8e-14 TIGR01783: TonB-dependent siderophore receptor" amino acids 135 to 786 (652 residues), 286 bits, see alignment E=3.7e-89 PF00593: TonB_dep_Rec_b-barrel" amino acids 307 to 753 (447 residues), 154.2 bits, see alignment E=2.1e-48

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 57% identity to sli:Slin_5755)

Predicted SEED Role

"TonB-dependent siderophore receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3R2 at UniProt or InterPro

Protein Sequence (786 amino acids)

>Echvi_3406 TonB-dependent siderophore receptor (Echinicola vietnamensis KMM 6221, DSM 17526)
MKGFVLLLVMVGFCQLAMAQASGTITGEVKNESGDMLSFASIILKGTNYGVASDANGAFE
FMAPAGNYTLIISEIGFQSINKRITVRSGQTIDMGTVVLKEKESELGEVTVVGERNEYTV
DEPSGSLRLNEKLIEVPQNIQVVTAQALEDQQIIDMSDGVLRNVSGATRLEHWGNLYARV
NMRGSRAGAFRNGMNVTSNWGPLNEDMSFVETIEFVKGPAGFMMSNGEPSGIYNVVTKKP
TGVTRGEVNLTMGNYDLYRGTLDLDGKLSKDGKLLYRLNVMGQTQNSFQDYTFTDRYSVA
PVVSYQLDDKTKLTLEYVYQHVNMSNVGSAYVFSTEGYGIYDQSFTIAEPGLDPTKIDDH
SVMANLQHDISDNWKVTAQLAYFNYQQEGSSMWLNNVDADGNLLRYVSIWDALNQNAFGQ
VFVNGEVKTGGVNHRVLAGLDIGTKEYIADWSQSHQLDSINGGFFNMNNPVYGRPVNGLP
QFDRSQSLRQRANTSSITQSYSGFYLQDELGFFENALRLTLAGRYTYVNQNSYGAVDEDS
RITPRVGLSYSINDQTSVYALYDQAFVPQTGVLKSGEPVKPITGNNMEFGAKREFFNGKW
STGLSLYRIFKNNQMVSDPENPTAQYSLLTQTTTQGVEFDARGEIIPGLIVTANYAYTDS
EITDDERTGEFSQVGSPVPGFAKHVANGWLTYSIQSGVLEGLGVSAGFTYQADRTTWNWP
GDNQLALPNYFKLDGGLSWENDNLTIRANVFNLLNEYLYSGSAYATYYYYQAEAPRNARL
SVGFRF