Protein Info for Echvi_3374 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Pseudouridylate synthases, 23S RNA-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00849: PseudoU_synth_2" amino acids 12 to 165 (154 residues), 109.7 bits, see alignment E=8e-36

Best Hits

Swiss-Prot: 44% identical to TRUC_VIBPA: tRNA pseudouridine synthase C (truC) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K06175, tRNA pseudouridine synthase C [EC: 5.4.99.12] (inferred from 46% identity to vfi:VF_0613)

Predicted SEED Role

"tRNA pseudouridine synthase C (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G447 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Echvi_3374 Pseudouridylate synthases, 23S RNA-specific (Echinicola vietnamensis KMM 6221, DSM 17526)
MTELEILFEDEHYIAVNKPAGVMVHRSSIAKDDDPIYAMQVLRDQMGHHVYPLHRIDRPT
SGVLWFARNPDVVPAFQEQFINQNIRKSYLTVVRGYTKEAKGIIDYPLRKNLKKELQEAQ
TEYERIGQVEIPFQSSPRHDTSRYSLVRAHPLTGRMHQIRRHLAHERNYIIGDNTHGDNR
QNRFFRMHFHMHHMLLHARSTAFDHPITGAPVLVTAPLPDYFEKIVTTFGWKSLV