Protein Info for Echvi_3364 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 23 to 32 (10 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details PF23441: SDR" amino acids 9 to 228 (220 residues), 54.6 bits, see alignment E=2.2e-18 PF00106: adh_short" amino acids 12 to 202 (191 residues), 199.6 bits, see alignment E=7.8e-63 PF08659: KR" amino acids 14 to 174 (161 residues), 47.2 bits, see alignment E=5.2e-16 PF13561: adh_short_C2" amino acids 18 to 254 (237 residues), 236.1 bits, see alignment E=8.7e-74

Best Hits

Swiss-Prot: 44% identical to DHRS4_RABIT: Dehydrogenase/reductase SDR family member 4 (Fragment) (DHRS4) from Oryctolagus cuniculus

KEGG orthology group: None (inferred from 56% identity to sli:Slin_1313)

MetaCyc: 34% identical to 2-(R)-hydroxypropyl-CoM dehydrogenase subunit (Xanthobacter autotrophicus Py2)
2-(R)-hydroxypropyl-CoM dehydrogenase. [EC: 1.1.1.268]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.268

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G438 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Echvi_3364 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Echinicola vietnamensis KMM 6221, DSM 17526)
MDLSSLFSLNNKVALITGASKGIGLSIAEFFAAAGAKVVICSRHQEHLDEIAKKLYEKGY
DIMGIACNVGRPNELVQLVEKTIEAYGQIDILVNNAGTNPYMGPVHETTLELFDKIMDVN
VKAPFELSKLCLPHLRKSSQASIINISSIGALSPEPQLGIYSVSKSALHSLTKVCAKEWG
QQKIRVNAICPGIIKTNFSKALWGNDQIMDVIMKRLAIKRLGKTEEIAALALFLASPAAS
YISGSIFTVDGGFTS