Protein Info for Echvi_3363 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 55 (26 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 142 to 169 (28 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 248 to 272 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 18 to 278 (261 residues), 86.5 bits, see alignment E=1.3e-28 PF03631: Virul_fac_BrkB" amino acids 25 to 280 (256 residues), 165.4 bits, see alignment E=1.1e-52

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 44% identity to mtt:Ftrac_2469)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G091 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Echvi_3363 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKKLRKFTIFTILFDSVKAFGQSESMTFAASIAFYTIFSMPALLVIVLNIGATFYSRGE
VRDELLAQISDLSGMEMANMLDEIIYNAALDVDGFWARTIAIGVLVFSATTVFVSLQNSI
NHIWHIKPKPEKGLIKFVVNRLLSFSMVASIGFVLLISLVIDTAIVIFFNELSMLFEGLS
SYLAAITNFIITQAMMVLIFGLMYKILPDAQVKWRSVWLGAFCTMLLFALGKYLIGFYLG
NSDIGSAYGAAGSLVIFLVWVYYSVIIFLYGAQVTFYIAENTGRGIKPVKNAVKIQVKEI
EDTEDIEED