Protein Info for Echvi_3345 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF12146: Hydrolase_4" amino acids 70 to 272 (203 residues), 79.3 bits, see alignment E=5.6e-26 PF00561: Abhydrolase_1" amino acids 71 to 320 (250 residues), 89.7 bits, see alignment E=5e-29 PF12697: Abhydrolase_6" amino acids 72 to 324 (253 residues), 72.1 bits, see alignment E=2.1e-23 PF03096: Ndr" amino acids 114 to 171 (58 residues), 25 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: None (inferred from 78% identity to lan:Lacal_2213)

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2P5 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Echvi_3345 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTTLIFALTFLLGSTIHGYSQSPDLKWLDIELSNYQYPYEVHTIDLSVQEQTLHMAYMD
VMPDNYNGKNIMLLHGKNFNGAYWETTIEALVQEGFRVIIPDQIGFGKSSKPDHFHYTFQ
QLAQNTKAVLDKIGVNQTAVLGHSMGGMLATRFALMYPEITEKLILENPIGLEDWKLKVP
YKPVEWWYQNELKKDYDAIKKYQLENYYDNQWEPAYDEWVNLLAGWTFNSDYKTIAWNAA
LTYDMIFTQPVVYEFENITVPTLLIIGTRDRTALGKPLVSEEVRATMGRYDELGKKTQEK
IPNAQLVEIKDTGHLPHIERFERFISPLLAFLKP