Protein Info for Echvi_3335 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: flavoprotein, HI0933 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03486: HI0933_like" amino acids 4 to 397 (394 residues), 264.2 bits, see alignment E=6.2e-82 PF01134: GIDA" amino acids 4 to 40 (37 residues), 22.2 bits, see alignment 3.8e-08 PF12831: FAD_oxidored" amino acids 5 to 34 (30 residues), 28.3 bits, see alignment (E = 6.2e-10) TIGR00275: flavoprotein, HI0933 family" amino acids 6 to 397 (392 residues), 444.8 bits, see alignment E=1.3e-137 PF00890: FAD_binding_2" amino acids 6 to 101 (96 residues), 40 bits, see alignment E=1.7e-13 PF13450: NAD_binding_8" amino acids 6 to 36 (31 residues), 22.7 bits, see alignment (E = 5.4e-08) PF22780: HI0933_like_1st" amino acids 185 to 345 (161 residues), 103.9 bits, see alignment E=4.7e-33

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 53% identity to mtt:Ftrac_1079)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2N7 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Echvi_3335 flavoprotein, HI0933 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MGEIGVIGGGAAGFFAAIHAAQKGAKVIIFEKTGKTLSKVKVSGGGRCNVTHAAFQLSQL
VKHYPRGEKFLKKAFKKFQVQDTVEWFESKGVKLKTESDGRMFPISDLSQTIIDLLRQEA
DKLGVKVKTRASVEHISRDGSGFVLRVNGEDRAMDKVIVAAGGSPKSNSYQMYRELGHSV
VDPIPSLFTFNTPEAELKKLPGLTVPNAQVRIEGTKLTYEGPLLITHWGISGPVVLKLSA
FGAKWLHEHVYHTNVHIRWKADMKEAEIREALRVYKQRYPKRKVHAHPLFDLPKRLWGHL
AESAGIDESLTWSECVKKQINILEQHIFCYILQVKGKTTFKEEFVTAGGVALKDVNPATM
ESRLVPNLFFAGEVLDIDGITGGFNFQAAWTTGYIAGLSTHN