Protein Info for Echvi_3311 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulator/sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 135 to 155 (21 residues), see Phobius details PF00480: ROK" amino acids 9 to 303 (295 residues), 146 bits, see alignment E=8.9e-47

Best Hits

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 45% identity to lby:Lbys_2938)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.2

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G051 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Echvi_3311 Transcriptional regulator/sugar kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNQNEHFLGVDVGGTHLKIGKVSQQGEIVSFDKEDTSHYKEDPKGFNTCFVDVIGKYLS
KYPDINKVGIGLPGLINKERTTTLEIPAIPELNGFDLKGALLEKYPEKSFFLENDASAAA
MGEYKFASSRPSANFLFITMGTGIGSAAVVEGAIFKGARGNAMEMGHMLSRGNARLETII
GRKGILSIMKRMIDAYPEKAGVLLEKELGTHLLVDTAKEGNEVSLMTFEEVGDILGEAIV
STIRVLDINEVYFGGGISAGLEFMMPSLEKTVRQYLTHYYTDDLQLKKATLGNNAGTQGA
AALCF