Protein Info for Echvi_3299 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dipeptidyl aminopeptidases/acylaminoacyl-peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00930: DPPIV_N" amino acids 236 to 497 (262 residues), 73.8 bits, see alignment E=2.7e-24 PF07676: PD40" amino acids 394 to 414 (21 residues), 13.8 bits, see alignment (E = 1.1e-05) PF02129: Peptidase_S15" amino acids 542 to 687 (146 residues), 31.9 bits, see alignment E=2.8e-11 PF20434: BD-FAE" amino acids 550 to 670 (121 residues), 28.9 bits, see alignment E=2e-10 PF00326: Peptidase_S9" amino acids 590 to 785 (196 residues), 157.7 bits, see alignment E=8e-50

Best Hits

KEGG orthology group: None (inferred from 68% identity to zpr:ZPR_0345)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2K1 at UniProt or InterPro

Protein Sequence (787 amino acids)

>Echvi_3299 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKVYFLFLIVFGSILTSSAQQSTLTVEKIMQDPKWMGTFPSNINWGADGKTIYFHYNPE
KDPADSLYKITLSDTENIIKVPVEEEEHLLPSSGDFNKAKDLKVYTRNGILFLYDFENGQ
EQQLLELGERISQPVFLADEDFIAFQATNNVFTYHRSSGKIKKLTNIISGEKPAEKASQL
SEKEDWLKSENLELLQVIQEREDKKEKRKAYREATKTPEKFAFYTDKKRLANLSISPNAE
YVTFNLITPSKERKNTFVPDYADASGYTTDLDARPKVGDEASKVEMAIYNLEKDTVYFVQ
TDQLPGIKDLPDYVSDYPEREWEKKNRSVSTSGAYFSRDGQAIVNIRSADNKDRWIALIN
LEDGTLETLDRQRDEAWIAGPGIGYSFWGGTLGWLPDGKHVYFQSEETGYSHLYLYNVEK
GTKTALTEGEYEVFSPMLSRDGKHWYLTTSAVHPGERHFYKMPVMGGKMEKLTSMEGNNQ
VSLSPDEKHMAILHSYSNRPWELYLKESNTKAKPIQLTAGQSTAFEAYEWRDPQLIHFEA
ADGAKVPARLYTPAPSAANGAAVIFVHGAGYLQNAHKWWSSYFREYMFHNLLTDLGYTVL
DIDYRGSAGYGRDWRTGIYRHMGGKDLSDQVDGAHYLTQQMGIDPERIGIYGGSYGGFIT
LMALFNEAETFSSGAALRSVTDWAHYNHGYTSNILNEPVNDPIAYRRSSPIYFAEGLEGN
LLIAHGMVDVNVHFQDVVRLSQRLIELGKDNWEMAVYPVEDHGFVEPSSWTDEYKRILKL
FNDTLLK