Protein Info for Echvi_3290 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fatty-acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details PF00487: FA_desaturase" amino acids 6 to 235 (230 residues), 60.3 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: K00507, stearoyl-CoA desaturase (delta-9 desaturase) [EC: 1.14.19.1] (inferred from 63% identity to dfe:Dfer_0451)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G032 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Echvi_3290 Fatty-acid desaturase (Echinicola vietnamensis KMM 6221, DSM 17526)
MILIVFFLLHWYFSLFCQSFFLHRYAAHQMFIMNKFWEKFFYLFTWACQGSSYLSPRAYA
ILHRMHHAYSDTPKDPHSPHHTENLFTMMWKTKNIYNDYFSFRLKPEERFSKDVPDWKKF
DLMADSMFVRVAWGLIYVAIYVLSISVFELAGTHWWMYFLLPIHFLMGPVHGAIVNWSGH
KYGYANFDNNDQSKNSLLLDVLMLGELFQNNHHKLPNRPNFAVKWYEFDPTYPVVKLLHF
TRIIKLRTT