Protein Info for Echvi_3288 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TonB family C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 820 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details PF05569: Peptidase_M56" amino acids 174 to 258 (85 residues), 51.5 bits, see alignment E=1.4e-17 PF03544: TonB_C" amino acids 430 to 509 (80 residues), 50.3 bits, see alignment E=4e-17 amino acids 555 to 632 (78 residues), 62.9 bits, see alignment E=4.7e-21 TIGR01352: TonB family C-terminal domain" amino acids 557 to 633 (77 residues), 45.8 bits, see alignment E=6.1e-16

Best Hits

Predicted SEED Role

"Regulatory sensor-transducer, BlaR1/MecR1 family / TonB-dependent receptor" in subsystem Iron acquisition in Vibrio or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1Y3 at UniProt or InterPro

Protein Sequence (820 amino acids)

>Echvi_3288 TonB family C-terminal domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MAHLIDYIWQSSFCLLFFFGIYWCFLRREKVFGFTRVFLLITPVLALLFPLIEIPVEFSK
PTISLENTDFLQYLTAQEAKEDIAASYGLPEVTVESTKLPILLEWKDYLFLGYLVIALLL
TFRLLWQFLQLRLLTEKGWYQTVFNLKSSYFLIPTFGLAPVFSFFNRLFWDDSQELRPEE
KEHIIKHEIEHIRQGHSWDMMYYQVLSILFWFNPGIHLMRSALIDTHEYSADANVVKQAA
NKDTYTNLIVKIAFKGLDLPVGNYFIRSTTLKRIMMMKNNKKTNWFKLLMVVPLTGMLLG
LVSMKTISTSGFFNTESSMSLANMKELIEQAQDTINVSTRVVHIPNPTHYEYVSDLKDGK
VTAQLGNLQYEIGDISNDQEYADVMAMINVFKRHSNFIKKYDTQELHTSADKMPEAKGGM
GEWNKFLSKNLKYPTQARKMGMTGDIYIEFVVSKAGEVLQPTLKKSLGMGLDDEILRIFS
LESMPKWNPGIIDGKPVNTLMVLPIRFKLKGEVAKSSTFFSPPSYASDKEVFDVVENMPS
PQGGMEGWTDYVSKNLIYPKTAQEKGVEGTVYVSFIVDEDGSLQNPKILRGIGSGADEEA
MRLVANAPKWTPGQQRGKNVPVEMKVPIKFELNTKAIGTPQPNQLDDVVVVGYNTVSIKK
DDNGRPQKPAIDSSGKFDEIGEDPLYVINGEEYPKEDISKVSPEDIKSINVLKGASAIEK
YEDNGKHGVIEITLKEGVSLPKKQPASSIQKTKNSEPKLTLGADPIFMVDDAFTRKSELK
NAYDPEDIESISILKNGDAINLYGKNAQNGVVLITTKNNP