Protein Info for Echvi_3256 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: AraC-type DNA-binding domain-containing proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 23 to 40 (18 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details PF12833: HTH_18" amino acids 264 to 344 (81 residues), 34.1 bits, see alignment E=2.8e-12 PF00165: HTH_AraC" amino acids 308 to 344 (37 residues), 33.2 bits, see alignment 4.4e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1T2 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Echvi_3256 AraC-type DNA-binding domain-containing proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MMIAAILWWYPNVTPGQKTPKRILAVSFLVLFSWHTFQFLDATYMEQGYQYFHKTMVLLS
MSLFLPLTYLYFHTLAFSSFGKSILIHLVLPAIIGIMAIHYVHNSNAITSDLPYLLVHLQ
MIIYWILEINLVIKLTSISKKGLIHINTHWIRWTLGFITIQSLLFFPYFLVALTGISLPP
LLRPEIIGIIAGFMLSLSLFFQPFLLFGIRDIKSKDFSDKAHFNLLAKGLEKMNANLSIE
EQSIERYVSKHHPYLNKDITLDHMAAQIGVSNNCIKSYLKKKGVNFEEYLNLKRILFSQN
IIKEKVYHDMTLDMLAKQSGFIDRKSFISSFKKHTGYSPSDYIKHFF