Protein Info for Echvi_3231 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Type IV secretory pathway, VirD4 components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details PF14293: YWFCY" amino acids 5 to 147 (143 residues), 147.8 bits, see alignment E=4.4e-47 PF02534: T4SS-DNA_transf" amino acids 164 to 561 (398 residues), 50.4 bits, see alignment E=3.4e-17 PF10412: TrwB_AAD_bind" amino acids 432 to 554 (123 residues), 32.2 bits, see alignment E=1.1e-11 PF12696: TraG-D_C" amino acids 459 to 570 (112 residues), 52.4 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 90% identity to psn:Pedsa_1580)

Predicted SEED Role

"Putative mobilization protein BF0133" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1Q1 at UniProt or InterPro

Protein Sequence (673 amino acids)

>Echvi_3231 Type IV secretory pathway, VirD4 components (Echinicola vietnamensis KMM 6221, DSM 17526)
MQGEDDLRGLAKIMAFMRAVSILLVLMHLYWFCYGFFSERGWILEIINKILGNFNRTAGL
FSHPLYTKLFALVLLALSCLGTKGVKNEKITWSKIFVALGIGFVLFFLNTPLLKLSPVAG
TSLYILTLAAGYIALLMAGVWMHRLLNNNLMDDVFNSENESFMQETRLMENEYSINLPTK
FWYSKKQHNGWINVVNPFRATIVLGTPGSGKSYAIVNNYIKQQIEKGFSLYIYDFKFDDL
STIAYNHLLKHSDKYKVKPKFYVINFDDPRRSHRCNPLNPDFMTDISDAYEAAYTIMLNL
NRSWIQKQGDFFVESPIILLAAIIWFLKIYDNGKYCTFPHAIELLNKKYADVFTILTSYP
ELENYLSPFMDAWQGGAQDQLQGQIASAKIPLSRMISPQLYWVMTGDDFSLDINNPAAPK
ILCVGNNPDRQNIYSAALGLYNSRIVKLINKKGQLKSSVIIDELPTIYFRGLDNLIATAR
SNKVAVCLGFQDFSQLTRDYGDKESKVIQNTVGNVFSGQVVGETAKNLSERFGKVLQKRQ
SLTINRNDKSTSISTQMDSLIPASKISTLTQGMFVGSVSDNYDERIEQKIFHAEIVVDNE
KVAAETKAYREIPQILSFVDEQGEDKMKEQIENNYRQIKSDILGIVGNELERIKNDPSLQ
HLVVKESENKNNG