Protein Info for Echvi_3174 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Conjugative transposon protein TraO.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF10626: TraO" amino acids 24 to 185 (162 residues), 211.8 bits, see alignment E=3e-67

Best Hits

KEGG orthology group: None (inferred from 82% identity to psn:Pedsa_1553)

Predicted SEED Role

"Conjugative transposon protein TraO" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G333 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Echvi_3174 Conjugative transposon protein TraO. (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKYIYTVMFTLLGITMAQAQRMLPKQKGLEVSAGVLSNDKIGNDYYLQIGMTVNGKNGN
YQLWALEYAHQYYDYKDLRIPHETYMAEGGYSFFLLGDTRKNFTFNLGITGVVGYENINR
GEQMLYDGARILSEDNFVYGAGGRLSLETYLSDQVVFLIQGRTKVLWGTDLEQFRPSAGV
GLRFNF