Protein Info for Echvi_3161 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Lactate dehydrogenase and related dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 10 to 328 (319 residues), 91.6 bits, E=9e-30
• PF02826: 2-Hacid_dh_C
  • amino acids 109 to 297 (189 residues), 170.6 bits, E=5.7e-54
• PF07991: IlvN
  • amino acids 141 to 229 (89 residues), 20.8 bits, E=6.1e-08
• PF03446: NAD_binding_2
  • amino acids 145 to 259 (115 residues), 34.6 bits, E=4.8e-12

Best Hits

Swiss-Prot: 51% identical to DDH_ZYMMO: 2-hydroxyacid dehydrogenase homolog (ddh) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 99% identity to zpr:ZPR_3405)

MetaCyc: 41% identical to aromatic 2-oxoacid reductase (Clostridium sporogenes)
Indolelactate dehydrogenase. [EC: 1.1.1.110]; 1.1.1.110 [EC: 1.1.1.110]; 1.1.1.110 [EC: 1.1.1.110]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• L-tryptophan degradation IV (via indole-3-lactate) (2/2 steps found)
• pyruvate fermentation to (R)-lactate (1/1 steps found)
• L-alanine degradation II (to D-lactate) (2/3 steps found)
• vancomycin resistance I (2/3 steps found)
• heterolactic fermentation (12/18 steps found)
• mixed acid fermentation (10/16 steps found)
• 4-hydroxybenzoate biosynthesis I (eukaryotes) (2/5 steps found)
• L-phenylalanine degradation VI (reductive Stickland reaction) (2/5 steps found)
• L-tryptophan degradation XIII (reductive Stickland reaction) (2/5 steps found)
• L-tyrosine degradation V (reductive Stickland reaction) (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• L-alanine degradation VI (reductive Stickland reaction) (1/6 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (2/8 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (2/9 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (1/9 steps found)
• tropane alkaloids biosynthesis (2/11 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.28

Use Curated BLAST to search for 1.1.1.110 or 1.1.1.28

Sequence Analysis Tools

See L0G248 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Echvi_3161 Lactate dehydrogenase and related dehydrogenases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTTIYSTHKFDKPSIENANKGKHQLNFLEFRLTKETALLAEGSKAIALFSNDDASSEVL
DILHKLGIKFIALRSAGFNHVDLEKAAELNIKVARVPAYSPYAIAEHTMALILALNRRLI
KAHNRVREQNFSLNGLTGFDLNGKTVGVIGTGKIGSVLVKILHGFGCNILAQDIEESKDL
IDKYGLIYSDCATLCKHADIISLHVPLKASTKHLINKEHIALMKSGVMLINTSRGGLVDT
KAVIEGLKTKKIGYLGLDVYEEEEGLFFEDHSDDILQDDVIARLMTFNNVLITSHQAFLT
KTALTNIAETTIYNLDCFEKQKPSGNEISIN