Protein Info for Echvi_3157 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glyceraldehyde-3-phosphate dehydrogenase, type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01113: DapB_N
  • amino acids 3 to 107 (105 residues), 27.5 bits, E=2.9e-10
• TIGR01546: glyceraldehyde-3-phosphate dehydrogenase, type II
  • amino acids 4 to 336 (333 residues), 330.3 bits, E=6.9e-103
• PF02800: Gp_dh_C
  • amino acids 190 to 295 (106 residues), 32.9 bits, E=4.9e-12

Best Hits

Swiss-Prot: 42% identical to G3P_METST: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)

KEGG orthology group: K00150, glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC: 1.2.1.59] (inferred from 96% identity to zpr:ZPR_3400)

Predicted SEED Role

"NAD(P)-dependent glyceraldehyde 3-phosphate dehydrogenase archaeal (EC 1.2.1.59)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 1.2.1.59)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• glycerol degradation to butanol (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• Bifidobacterium shunt (11/15 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• heterolactic fermentation (12/18 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• oxygenic photosynthesis (11/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.59

Sequence Analysis Tools

See L0G3G1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Echvi_3157 glyceraldehyde-3-phosphate dehydrogenase, type II (Echinicola vietnamensis KMM 6221, DSM 17526)
MKEIGVIGYGVIGKRVADAIKLQDDMKLSGVCDIISDWRIQNAVRKEYDIYAATEEAAND
MDSKGISVKGSLQELLKKSDLVVDCTPKKIAAQNVVIYKEQNIKFILHGGEKHETTGHSF
SAENNYKSALNLNATRVVSCNTTSILRTLTALKRADLLDYARGTLLRRATDPWESHLGGI
MNTMVPEKDIPSHQGPDAKSVDPELDVITAAVKVPETLSHMHYWNVKLKKQATKEEVLNA
FKTSSRIKLIRYDQGLVSNNTIKEMFLDMGRPWGDMYEVALWEDMLKVQGDELFYAYVVD
NQAIVIPETIDAIRALTGIETNGTKSIVKTNESLGIY