Protein Info for Echvi_3155 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Universal stress protein UspA and related nucleotide-binding proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF00582: Usp" amino acids 2 to 148 (147 residues), 93.1 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to zpr:ZPR_3397)

Predicted SEED Role

"Universal stress protein family" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G244 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Echvi_3155 Universal stress protein UspA and related nucleotide-binding proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MKILLAIDGSDFSKVAIHELIKMTLSSNSEIHIINVYEVPKTTGLGLHTMGGRIGNYIEE
IRSNAQKLGNKIVSEAFDKIKAENKALTITTSVVSGLPKSTIYEKAEDWGADLIVVGSQG
HGALSRLVLGSVSQYLTTNAKCSVLIARDRNKK