Protein Info for Echvi_3141 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phage/plasmid-related protein TIGR03299

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR03299: phage/plasmid-like protein TIGR03299" amino acids 17 to 340 (324 residues), 227.1 bits, see alignment E=1.5e-71 PF06067: DUF932" amino acids 92 to 325 (234 residues), 233.5 bits, see alignment E=1.4e-73

Best Hits

KEGG orthology group: None (inferred from 94% identity to lby:Lbys_0144)

Predicted SEED Role

"Mycobacteriophage Barnyard protein gp56"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G302 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Echvi_3141 phage/plasmid-related protein TIGR03299 (Echinicola vietnamensis KMM 6221, DSM 17526)
MAHNLNFNERTGRYSFFSVQQKAWHGLGQIVEQYPTSEEAIKYAGLDYEVVKSPLFTKGS
GIIETANGIEIGSNELEVPNYFANIRTDNNVVLGVVGKDYHIVQNREAFNFFDAIVGGGE
GILYETAGALGNGERIFITAKLPDYIRVGNGDDVTEKYIFLTTSHDGSGSITAAFTPIRI
VCQNTLNASLRNMTNVVRIKHTSGAKQRIENAHRIMGLANTLSNQLEGIFNEWTKVKVTD
REVRKLIQLALCPNKETLDLIKKGAEDEISTVFKNTVDDAFAYAMISDTQQMDTTKGTLF
GAYNAVTGYYQNVRNYRNEEAKLQSIVLGGTAQLKSQKAFEWCNAFATDGADILNLN