Protein Info for Echvi_3119 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycerophosphoryl diester phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03009: GDPD
  • amino acids 46 to 158 (113 residues), 101.2 bits, E=5.2e-33

Predicted SEED Role

"Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 3.1.4.46)

MetaCyc Pathways

• glycerophosphodiester degradation (2/2 steps found)
• glycerol and glycerophosphodiester degradation (3/4 steps found)
• phosphatidylcholine resynthesis via glycerophosphocholine (1/2 steps found)
• phospholipid remodeling (phosphatidylethanolamine, yeast) (1/4 steps found)
• anandamide biosynthesis I (3/12 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.46

Use Curated BLAST to search for 3.1.4.46

Sequence Analysis Tools

See L0G1D1 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Echvi_3119 Glycerophosphoryl diester phosphodiesterase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNRIKIRPIYFWAVLALMSCGSLCHGQVAAIQERFLHSDHLMVASHRAAHQHYPENSLAA
IQEAITIGVDIIELDIRVTRDGVPVIMHDQTIDRTTTGIGDIEQLDYGDIHSLKLLHQGK
VTDQSIPTLQEALMLCKGKVMVDMDMKTDKIDEVVEVVKAIGAIDQLIFFDADWEVLERI
SHKLDGAHLMPRAYKPNDIKKAVKRLDPVAIHIDPSFYTAKTIKLANKHGLRIWINSLGD
RDKALKRAPDVQASCKWLEKGANMVQTDLPEFWVSVRESLDE