Protein Info for Echvi_3113 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Putative heme degradation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF06228: ChuX_HutX" amino acids 32 to 162 (131 residues), 109.7 bits, see alignment E=1e-35 amino acids 213 to 343 (131 residues), 85.3 bits, see alignment E=3.6e-28 PF05171: HemS" amino acids 36 to 166 (131 residues), 98.5 bits, see alignment E=3e-32 amino acids 216 to 347 (132 residues), 130.9 bits, see alignment E=2.7e-42

Best Hits

KEGG orthology group: K07225, putative hemin transport protein (inferred from 42% identity to pae:PA4709)

Predicted SEED Role

"Hemin transport protein HmuS" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2X3 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Echvi_3113 Putative heme degradation protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MMNTEIKTAQHIKERYQQFKDHNSKVRIREAAKKLGVSEAELLSTSIGEGVVRLEGNWAD
FILQCRDLGRIMALTRSEGCVLEHKGTFQKISIHGSAPHQVATVIGPIEQRIFFSNWKFG
FAAEIQGVRGLMKSFQFFDQAGQAIMKIYLQKESNEDVFEQLKNEYKALDQMADLDIEAI
EVPEYTTDIDEAAFRKEWEEMKDTHAFFGMLKRYKLHRQEALRKIGDKWAYRVDRLVVRD
ILEKAAEQELPIMVFAGNRGNIQIHQGKVKNLHQIDNWFNVMDPDFVMHLNEDTIDEAWV
VHKNTDDGVVSSLELFDPSGELIAQYFGLRKPGIPQNAAWKKLMDALPKRSL