Protein Info for Echvi_3103 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF00532: Peripla_BP_1" amino acids 62 to 315 (254 residues), 90.4 bits, see alignment E=2.9e-29 PF13407: Peripla_BP_4" amino acids 64 to 314 (251 residues), 49 bits, see alignment E=1.3e-16 PF13377: Peripla_BP_3" amino acids 173 to 336 (164 residues), 97.1 bits, see alignment E=2.5e-31

Best Hits

KEGG orthology group: None (inferred from 53% identity to hhy:Halhy_4304)

Predicted SEED Role

"LacI family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2W4 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Echvi_3103 Transcriptional regulators (Echinicola vietnamensis KMM 6221, DSM 17526)
MSGVNIKKLAEALNLAPSTVSRALNDSYEISEKTKKRVLDMAKQMNYQPNPFARSLREHR
SKTIAMIIPDLVNNFFAQVIEGVEEITQQFGYHLLVYHTHEDVEKEKEIVTHLLNGRVDG
IMMSVSHQTKDIEHLHNVYERRIPIIFFDRICETIPTTKFVTNGYESGYELASHMIKEGC
RRIAFLLLSQEISISQQRLRGYLDALKDHGIAQDDSLVLKCVNADEDNHRIIKDFLCSEV
NPDGVLAAVEKLAISTYHVARDLQLTIPDQLKVACFSNMKIADLLAPSLTTVAQPTHEFG
RQAASLLMNKLTKKNAPDFEDEVIVLPSTMHIRKSSMAHN