Protein Info for Echvi_3100 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF03786: UxuA" amino acids 1 to 376 (376 residues), 430.3 bits, see alignment E=4.8e-133 TIGR00695: mannonate dehydratase" amino acids 2 to 377 (376 residues), 554.6 bits, see alignment E=6.7e-171

Best Hits

Swiss-Prot: 63% identical to UXUA_BACTN: Mannonate dehydratase (uxuA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 66% identity to hhy:Halhy_1062)

MetaCyc: 59% identical to D-mannonate dehydratase (Escherichia coli K-12 substr. MG1655)
Mannonate dehydratase. [EC: 4.2.1.8]

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.8

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1Y9 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Echvi_3100 mannonate dehydratase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRWYGPQDPVTLADIRQAGATGIVSALHHLPNGVIWSREEIKKRKDTIEAAGLTWSVVES
IPVHENIKTRSGNYQEYIANYKTSIGNLAAEGIHTVCYNFMPVLDWTRTDLAYELPNGAK
ALRFELQALAAFDLFILQRPNAEKDYSEQVIKRAEAYFKEMTEDAEQLLTNNIIAGLPGA
EEGYSLKAFQQVLDTYQHIDADKLATNLRLFLEEIIPTAEKNRVFMAIHPDDPPFPMFGL
PRVMSTIDDVKRLVTETPSEYNGITFCTGSFGVRADNDLPQIIREHGDHIHFIHLRSTQR
DAYGNFHEANHLEGDVPIVAVIKELIKVQSRRQKSLPMRPDHGHQMLDDLRKTTNPGYTG
IGRLKGLAELRGLEMGLLHGLE