Protein Info for Echvi_3000 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Di- and tricarboxylate transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 45 (18 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 92 to 119 (28 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 403 to 436 (34 residues), see Phobius details amino acids 448 to 466 (19 residues), see Phobius details amino acids 486 to 506 (21 residues), see Phobius details amino acids 508 to 526 (19 residues), see Phobius details amino acids 532 to 551 (20 residues), see Phobius details amino acids 571 to 593 (23 residues), see Phobius details PF03600: CitMHS" amino acids 16 to 527 (512 residues), 257.9 bits, see alignment E=2.1e-80 PF02080: TrkA_C" amino acids 312 to 379 (68 residues), 47.6 bits, see alignment E=1.9e-16 PF00939: Na_sulph_symp" amino acids 423 to 586 (164 residues), 66.2 bits, see alignment E=4.6e-22

Best Hits

Predicted SEED Role

"Sulfate permease, Trk-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1Q3 at UniProt or InterPro

Protein Sequence (595 amino acids)

>Echvi_3000 Di- and tricarboxylate transporters (Echinicola vietnamensis KMM 6221, DSM 17526)
MTPEIITVLAIIAVAMVLFLSEKWSIDTVSIMVMLAFMVSGILTFEEGVAGFSNPATITV
GAMFVISAAVFRTGSLNTINILFLRMGRKNEYAFMFILMVFSGVLSAFINDTAVVALLMP
TVLKIAKDTGITPSKLLMPLSFGALMGGVCTLLGTSTNILVSGIAQSHGAKPFGIFEMSG
MGLIFLASGIAYMMTIGQWIIPKRQPSRNISETFDMGDYITEVFVTKKFEDTGKSIKMSR
LFTDYNMDPIQIIRKTGEVINAYKYTVIREEDTIRVRCDKDTLTQIRNIPGIELKIDLKL
KDEDFRSQGHKLYEMVVPPNSSLINNTVKSIDFRRTYPGLTVLAIRHRNDILHTKLKNTK
ISAGDVLLVRGDEEMVDQLKGSDSLLVISEDTSPRMVWKKIAFTIFIVAAVITVAGFKLL
PIPIAAIFGVVLLILFKSISAEDAYRSVDWKVLFMLAGILSMGTALEKTGAANLLANTLV
AQLGDFGPRTIMSVVFLVTFLSTNIMSNNATAALLAPIAISIASALDVSDRPFLMAVTFA
SSLSFMTPMGYQTNTMIYTPGNYKFTDYLKVGTPLNIMFWIIATFCIPIFFPFDK