Protein Info for Echvi_2989 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Protein of unknown function (DUF1573).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07610: DUF1573" amino acids 33 to 127 (95 residues), 80.5 bits, see alignment E=8e-27 amino acids 269 to 355 (87 residues), 61.4 bits, see alignment E=6.8e-21 PF22544: HYDIN_VesB_CFA65-like_Ig" amino acids 37 to 127 (91 residues), 39.8 bits, see alignment E=4.4e-14 amino acids 264 to 361 (98 residues), 40.6 bits, see alignment E=2.6e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0Z9 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Echvi_2989 Protein of unknown function (DUF1573). (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNIQFISLSVLINFAFLLSVHAQAVVESPLIWERQKASLGSVMEEYGKVTTEFFVANDG
DAPVIIEEVETDCGCTTVDFVSDTLLHNQIGAIKVDYQPTGFGGDFEKKVVVKTNINPAG
DTLYLEGFNIPYPENVASYYDYKVGSLGFRFSSINMGDVFTNEPKIKYVDFYNFKDLPIT
LDHDHSGLPAHVKINMIPAIVPAKSRGLLAIQYDGAEKNDLGFFDEQVAFKIESRGDQGV
ELRLLTTVQEYFAPVPKSEVNQVPRLGVSEVEVDLGRISSKETVHHEITLSNMSPKEVNI
RKVVTNCDCMQFQLPSYDLSPGDKVTLTLTFDPSGRLGIDHKMVSIFSNDPLNPTRTIVF
KSRID