Protein Info for Echvi_2987 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein involved in D-alanine export

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 45 (16 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 229 to 261 (33 residues), see Phobius details amino acids 313 to 338 (26 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details PF03062: MBOAT" amino acids 152 to 352 (201 residues), 102.8 bits, see alignment E=2.5e-33 PF13813: MBOAT_2" amino acids 268 to 328 (61 residues), 26.2 bits, see alignment E=7.6e-10

Best Hits

Predicted SEED Role

"Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)" in subsystem Alginate metabolism (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G306 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Echvi_2987 Predicted membrane protein involved in D-alanine export (Echinicola vietnamensis KMM 6221, DSM 17526)
MLFNSIEFAFFLPIVFFIYWLVLKNTVKGQNIWLLIASYFFYGWWDWRFLFLILFSSIVD
YTIGLNLHKATKVSQRKLLLFLSVFINIGFLCYFKYFNFFLDSLNDAFTLLGKPLEASRL
SIILPVGISFYTFQTLSYTIDIYKRKLEPTKDIVAFFTFVSFFPQLVAGPIERASHLLPQ
FSRKRKFSYDMISQGGKLMLWGLFMKVVVADRLAIYVDDVYMLLERHSWLTLFTAHAFFA
FQIYCDFAGYSLIAIGCAKLFDFHLMDNFRRPYFATSFKSFWSRWHISLSTWFKDYVYIP
IGGNRQGDFRAGINLMITFIISGFWHGANWTYIIWGALHGFYQIMEKYVLKFKLPKAINW
LIVFGLTCLAWVFFRAPSVSDAMTVLQRIVTFQGTGLYFGDKGIFLFGVMGLFILLLHDY
IMEFKPNYQFLYHRSPIVRYAAIVILMMFITTFGVFDNSQFIYFQF