Protein Info for Echvi_2976 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Deoxycytidylate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 135 to 137 (3 residues), see Phobius details PF00383: dCMP_cyt_deam_1" amino acids 33 to 147 (115 residues), 82.5 bits, see alignment E=1.8e-27 PF14437: MafB19-deam" amino acids 33 to 151 (119 residues), 54.8 bits, see alignment E=9.6e-19

Best Hits

KEGG orthology group: K01493, dCMP deaminase [EC: 3.5.4.12] (inferred from 78% identity to mtt:Ftrac_0923)

Predicted SEED Role

"dCMP deaminase, putative"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ60 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Echvi_2976 Deoxycytidylate deaminase (Echinicola vietnamensis KMM 6221, DSM 17526)
MAFKKDYFSPCFISYVLLGNGKWENVMSKPDFDDIFMELAVNLAKRSHCIKKHVGAVLTK
ETRIISIGYNGPPSGTHNCDEEFPESGCSRDSKGSCSLAIHAEQNAILYAVKNNASVEGS
TLYVTLAPCLACARIIYSMGVAKVVYMYSYAAYKGLPYDEGVEFLKKFGVEVEHYDKEII
YEDHLI