Protein Info for Echvi_2957 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphoenolpyruvate carboxykinase (ATP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 TIGR00224: phosphoenolpyruvate carboxykinase (ATP)" amino acids 14 to 531 (518 residues), 723.5 bits, see alignment E=8.8e-222 PF01293: PEPCK_ATP" amino acids 23 to 485 (463 residues), 737.4 bits, see alignment E=3.2e-226

Best Hits

Swiss-Prot: 60% identical to PCKA_FLAJ1: Phosphoenolpyruvate carboxykinase (ATP) (pckA) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01610, phosphoenolpyruvate carboxykinase (ATP) [EC: 4.1.1.49] (inferred from 68% identity to mtt:Ftrac_0195)

Predicted SEED Role

"Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP or Serine-glyoxylate cycle (EC 4.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2X7 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Echvi_2957 phosphoenolpyruvate carboxykinase (ATP) (Echinicola vietnamensis KMM 6221, DSM 17526)
MISKTSPVTDQQRIHEQLDKGQLKLNLTPPELIEHALAQKEGWLTDTGALMADTGKFTGR
SPKDRYIVSDYKTKNTIWWGTINIPFMEAHFDGLLNKMTAYLKNRIIFARDMYAGADSRY
RLNVRVYNTLAWHNLFCHNMFLRPEEGETIDLETAYTIICIPEFEADPTVDGTRGKNFTI
INLTRKIILIGGTGYAGEIKKGIFSVLNYLLPLKEKVLSMHCSANIGKMGDTAVFFGLSG
TGKTTLSADPERKLIGDDEHGWTNNGIFNFEGGCYAKVIDLSEQKEPEIWRAIKFGSIVE
NTKFFPNSRTINFADSTTTENTRTAYPLYHIPQAIMPPLGTLPKNIFFLTADAFGVLPPI
SKLNPSQAMYHFISGYTAKVAGTEMGITEPQKTFSACFGAAFLPLHPTVYASLFGKKMKD
HNANVWLVNTGWTGGSYGVGSRMKLSHTRAMISAALEGKLDNVNYKNHPVFNVAVPQRCP
GVPQEILNPKDTWENPGEYDQKAFQLASSFVENFKKYEDFADEEIMAGAPTC