Protein Info for Echvi_2948 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 TIGR00665: replicative DNA helicase" amino acids 32 to 471 (440 residues), 555.2 bits, see alignment E=4.9e-171 PF00772: DnaB" amino acids 32 to 133 (102 residues), 115.5 bits, see alignment E=1.7e-37 PF03796: DnaB_C" amino acids 207 to 470 (264 residues), 373 bits, see alignment E=1e-115 PF13481: AAA_25" amino acids 213 to 387 (175 residues), 43.8 bits, see alignment E=3.4e-15

Best Hits

Swiss-Prot: 41% identical to DNAB_LEIXX: Replicative DNA helicase (dnaB) from Leifsonia xyli subsp. xyli (strain CTCB07)

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 74% identity to mtt:Ftrac_0118)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2G4 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Echvi_2948 replicative DNA helicase (Echinicola vietnamensis KMM 6221, DSM 17526)
MAERNTAGRERNPLRRKNNLEQGMAGGVGKIPPQAIDLEEAVLGALMLEKEAITAVVDIL
KPDSFYKDAHREIYDAILLLFNESEPIDLLTVTNKLRKNGKLEVAGGAYYITELTSKISS
AANIEYHARIITEMAMKRHMIRICSEIQKEAYEETTDVFELLDTMEQSLFEISENNIRKN
YADMKSIMREAITELEGKKDLSDGLTGVPSGFTALDRVTSGWQKSDLVIIAARPAMGKTA
FVLSVLRNAAVDHSRPVAIFSLEMSAVQLVNRLISSEAELDSEKIKKGNLADYEWEQLIH
KTSKLSSAPLFVDDTPALSILELRAKCRRLKAQSDIQMIVIDYLQLMSGDSKASASGNRE
QEISSISRALKKIAKELEVPVIALSQLSRAVETRGGDKRPQLSDLRESGAIEQDADIVMF
LYRPEYYGINEDEEGNSTLGTGEVIIAKHRSGSLETVKLRFIGKYTKFADLDLNVPYQPQ
GQEAMYGNKFPSAAGGKGFDDSNMIRIQSKANGPDEEDGFPGGLGSNEPAPF