Protein Info for Echvi_2940 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 4 to 187 (184 residues), 186.7 bits, see alignment E=1.2e-58 PF08659: KR" amino acids 5 to 152 (148 residues), 59.4 bits, see alignment E=1.6e-19 PF01370: Epimerase" amino acids 6 to 106 (101 residues), 31.8 bits, see alignment E=3.5e-11 PF16363: GDP_Man_Dehyd" amino acids 7 to 98 (92 residues), 27.2 bits, see alignment E=9.8e-10 PF01073: 3Beta_HSD" amino acids 7 to 114 (108 residues), 24.7 bits, see alignment E=4.1e-09 PF13561: adh_short_C2" amino acids 12 to 246 (235 residues), 205.9 bits, see alignment E=2.5e-64

Best Hits

Swiss-Prot: 37% identical to YXBG_BACSU: Uncharacterized oxidoreductase YxbG (yxbG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 56% identity to zpr:ZPR_4368)

MetaCyc: 37% identical to dihydroanticapsin dehydrogenase (Bacillus subtilis)
RXN-16285 [EC: 1.1.1.385]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30 or 1.1.1.385

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1J7 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Echvi_2940 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNKTILITGGASGIGLAMTKRFAEEGGNVYFIDYDQKTGEKVAEELTSKGHRVTFLQGD
VSQTEEMKQTISSISGSIDVLVNNAGISHVGNLENTAEEDFDRLYQVNVKGIYNCSLASL
PKMKEKGGSIINMASVASTMGLPDRFAYSMTKGAVFSMTLSMARDYVEYNIRVNSIAPGR
VHTPFVDGFLAKNYPGKEKEMFDKLAATQPIGRMGKPEEIAAMAVYLSSDEASFLTGGNY
PIDGGFVNLKM