Protein Info for Echvi_2923 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 820 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13715: CarbopepD_reg_2" amino acids 23 to 117 (95 residues), 55.5 bits, see alignment E=1.2e-18 PF13620: CarboxypepD_reg" amino acids 23 to 101 (79 residues), 52.6 bits, see alignment E=1.2e-17 PF07715: Plug" amino acids 130 to 217 (88 residues), 39 bits, see alignment E=2.6e-13 PF00593: TonB_dep_Rec_b-barrel" amino acids 353 to 730 (378 residues), 80 bits, see alignment E=8.6e-26 PF14905: OMP_b-brl_3" amino acids 387 to 799 (413 residues), 275.5 bits, see alignment E=2.2e-85

Best Hits

KEGG orthology group: None (inferred from 52% identity to cly:Celly_2848)

Predicted SEED Role

"TonB-dependent receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2E7 at UniProt or InterPro

Protein Sequence (820 amino acids)

>Echvi_2923 Outer membrane receptor proteins, mostly Fe transport (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKAIITIIFSCVLAPAMSQTGLKGTVIDQSQKTPLEYANIALYGLPDSTLIKGAVTDEN
GNYELMELDRGTYYLTVSFLGYLTIHTPSISVQKSQVKQLDPIALAPNEQLMSQVEVSGD
RYTTMHKIDRQVFEASSFEASKGGTATDLLRNLPGLSMDASGQISVRGTTGFVIMVNDKP
IQTDPSVFLSQIPANSIKNIEVVTAPSAKYDPEGKAGMINIITSKPIEDGTFVQINTKIG
LPSIQSYDNKVNPKRYGADFTINHRQGDWDLSVGGSYLRNDLAGRREGNVYTISGDTTTY
FPSDGERSFDEEMYSGRLTLGYTPSKQDLFSLGLYAGKRSKDRTADIIYYDNHAVVDDEE
IYQMQYYNENLRIRRSDFVIGSFDYEHTFTNASKLSSSFLYEYTMLGGPTTNRNLGYPDI
DVVYQDEYNTNDNPLHGIRFQTDYTAAPWKIGTFETGYQFRNLNHTGDFVYERKNTETGI
WELVPDFSSNVNLTRQIHSAYGLLSGEKGKWSYSAGVRLEYMDRELALKDKAGMVDTTYT
YDFVKPFPSASLQYHVNEELTLKAAYTKRVQRTTTFKMNPFPEREHSETLEQGDPTLLPE
FVDLVELGVIKDFGDHSFYATAYYSDIKNLVNRVNTIYNDTILNRIYSNVGSGTSLGIET
GIALAPTSWWKLFAGGNLYKYHIKGAFDDRPVDASTWVYSINANTTFDISSSLNLQWSLN
YLSDRVTAQGEDSRFFSPNLTVTKTFLDGRLSTSLQWLNMDMGLLHTNEQRITTWSENEF
YTTTNYVYEVDMFMLNISYTFNRIKNKARFIKSEFGDKEF