Protein Info for Echvi_2888 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cytochrome c oxidase accessory protein FixG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 37 to 448 (412 residues), 429.4 bits, see alignment E=8.4e-133 PF12801: Fer4_5" amino acids 91 to 129 (39 residues), 51.1 bits, see alignment 4.2e-17 amino acids 200 to 235 (36 residues), 12.9 bits, see alignment 3.7e-05 PF13746: Fer4_18" amino acids 217 to 322 (106 residues), 139.2 bits, see alignment E=2.6e-44 PF11614: FixG_C" amino acids 351 to 467 (117 residues), 62.4 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: None (inferred from 63% identity to mtt:Ftrac_1619)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0Q7 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Echvi_2888 cytochrome c oxidase accessory protein FixG (Echinicola vietnamensis KMM 6221, DSM 17526)
MSEKQQNSQEAFRDSLATVKPDGGRNWIYPKKVTGFFYKWRTWLSWLLLAMLFVGPFLKI
DGEPLLLLNVFERKFVIFGQVFWPQDTYILLFLLLILFVFIILFTVVFGRVFCGWICPQT
LFMEMVFRKIEYWIEGDASQQRKLNAMPWNRKKILKKGAKFGIFSLISLLIAHTVMAYLI
GIEETLETISHPPSENLAGFMGLLFFAGIFMLVFSLFREQVCTVVCPYGRLQGVLLDTNS
INVSYDYVRGEPRGKINKKKTEEPPKGDCIDCTLCVQVCPTGIDIRNGVQMECVNCTACM
DACDEVMEKVNRPKGLIRYASENSIKEGHQKLITPRVMGYSAVLVLLIAAFVGLLMTRTE
LSATITRFRGMTYQERTDGQVSNLYEATFINKTFEAQEVQIKAVDDRYQIEANDQGHWLL
EGQSKLEGRFFLVIERIDVQEINETVTLLLLQNGEVIDEISTNFMAPLPDKNK