Protein Info for Echvi_2860 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: sugar-phosphate isomerases, RpiB/LacA/LacB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF02502: LacAB_rpiB" amino acids 3 to 142 (140 residues), 161.3 bits, see alignment E=7e-52 TIGR00689: sugar-phosphate isomerase, RpiB/LacA/LacB family" amino acids 3 to 147 (145 residues), 144.2 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 42% identical to LACB_STAES: Galactose-6-phosphate isomerase subunit LacB (lacB) from Staphylococcus epidermidis (strain ATCC 12228)

KEGG orthology group: K01808, ribose 5-phosphate isomerase B [EC: 5.3.1.6] (inferred from 65% identity to shg:Sph21_4275)

MetaCyc: 39% identical to galactose-6-phosphate isomerase lacB subunit (Staphylococcus aureus)
Galactose-6-phosphate isomerase. [EC: 5.3.1.26]

Predicted SEED Role

"Ribose 5-phosphate isomerase B (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or LMPTP YwlE cluster or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.6

Use Curated BLAST to search for 5.3.1.26 or 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYW8 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Echvi_2860 sugar-phosphate isomerases, RpiB/LacA/LacB family (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIGIAADHGGFDQKQELYEYLKSNGHDVTDFGAFEFDESDDYPDKVKPLAIAVSKGEIQ
KGIAICGSGVGVTVAANKVPGVRAALITEPYSAHQGVEHDNMNLMCLGGRVMGGVVLKEL
VEIFITAEYVEKERFQRRLKKVQDLENEFLK