Protein Info for Echvi_2849 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: fructose-bisphosphate aldolase, class II, yeast/E. coli subtype

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01520: fructose-bisphosphate aldolase, class II
  • amino acids 3 to 352 (350 residues), 548.8 bits, E=5.1e-169
• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 11 to 352 (342 residues), 347.1 bits, E=8.2e-108
• PF01116: F_bP_aldolase
  • amino acids 12 to 351 (340 residues), 275.7 bits, E=2.5e-86

Best Hits

Swiss-Prot: 65% identical to ALF_EDWI9: Fructose-bisphosphate aldolase (fba) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 71% identity to lby:Lbys_3010)

MetaCyc: 64% identical to fructose-bisphosphate aldolase class II (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• formaldehyde assimilation II (assimilatory RuMP Cycle) (9/9 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• oxygenic photosynthesis (11/17 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

See L0G1B9 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Echvi_2849 fructose-bisphosphate aldolase, class II, yeast/E. coli subtype (Echinicola vietnamensis KMM 6221, DSM 17526)
MKFKPGIKFGEELKDLLEYAKESEFALPAVNVINTSTANAVLETAKKVNSPVIVQFSNGG
AQFFAGKGLANDKQQASIAGAVSGAMHVHKMAEAYGVPVILHTDHAAKKLIPWVDGMLEA
GKEYYAAFKKPLFSSHMLDLSEEPIEENIETSVKYLAEFKKLEMALEIELGVTGGEEDGV
DNTDIDSSKLYTQPEEVAYAYEKLREQSELFTIAAAFGNVHGVYKPGNVSLQPKILKNSQ
DYICEKFGLSGKPVSFVFHGGSGSSVEEIREATGYGSIKMNIDTDMQWAFWEGVLKYYKE
NEGYLQTQLGNPEGPDVPNKKKYDPRVWLRKGEENFVKRLEVAFDMLNAVDRN