Protein Info for Echvi_2846 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TonB-linked outer membrane protein, SusC/RagA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 988 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR04056: TonB-linked outer membrane protein, SusC/RagA family" amino acids 28 to 988 (961 residues), 788.4 bits, see alignment E=1.3e-240 PF13620: CarboxypepD_reg" amino acids 29 to 101 (73 residues), 45.1 bits, see alignment 2.1e-15 PF13715: CarbopepD_reg_2" amino acids 30 to 112 (83 residues), 74.2 bits, see alignment E=1.4e-24 PF07715: Plug" amino acids 120 to 235 (116 residues), 70.5 bits, see alignment E=3.3e-23 TIGR04057: TonB-dependent outer membrane receptor, SusC/RagA subfamily, signature region" amino acids 211 to 241 (31 residues), 62.2 bits, see alignment (E = 3.1e-21) PF00593: TonB_dep_Rec_b-barrel" amino acids 399 to 944 (546 residues), 79.1 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: None (inferred from 52% identity to cpi:Cpin_5092)

Predicted SEED Role

"SusC, outer membrane protein involved in starch binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2M2 at UniProt or InterPro

Protein Sequence (988 amino acids)

>Echvi_2846 TonB-linked outer membrane protein, SusC/RagA family (Echinicola vietnamensis KMM 6221, DSM 17526)
MQKISTVLKITVMCFSLLCGHIVCAQAQTVSGTVTDLDSGEPLPFVNVLLKGTTKGTTTD
IEGKYSISVNDPSDVLVFSFIGFDAKEVSVGNQSTIDVQLQGNTKQLDEVVVVGYGTQRK
ADLTGSVGSVVRDDFNVGQVTNPEQLITGKVSGVQITPNGGSPGSGGRIRIRGGASLNAS
NDPLIVIDGVPLDNSKTSGTANPLNFLNPNDIETFDILKDASATAIYGSRASNGVVLITT
RKGKEGQPLRVNVSSMVSVSQVANTVDMLDADQFRSVVTEEASASQAALVGEESTDWQEE
IYKDAVSFDNNVSISGAYKSLPYRVSVGYLDQDGILKTDNLKRTSASISLNPNFFDDKLH
VNFNVKGVITKSRFANQDAIGAAAAYDPTHPVYDPNGVGGYWEWLDDDGVPQTLAPRNPV
GLLMSKDDRGTVKRSIGNLQLDYELPFLEGLSANLNLGYDVSSSEGRAIIDANSASGYFE
GGSIAPYEQSKRNLLADFYLNYIKEFSNSRLNFLVGYSAQDFLIKNPTFARVNAEGDTLA
PAGVVSRPQYRLISYFARANYTINDKYLFTATVRADGSSRFSPDNRWGVFPSLAAAWRIS
EEDFLKASTVLTDLKLRLGYGVTGQQDIGTYFPYLPRYIQSDDATRYSFGDTYYTTLRPE
GYDENIKWEETTTYNVGLDYEFLDGKFYGTLDYYFKRTDDLLAVIPVPAGTNLTNQLFTN
VGSIENQGLEIGLNFNVVKTTDFNWDIGGNYTHSKSTIKSLSNVEEDAVGILVGGINGGT
GNTIQVHTVGYQPNSFYVYEQVYDENGTPLEGVYVDQNEDGLINEQDLKRNGFPDARHYF
GFNSSMRYKSWNFGFVLRGNAGNKVYNNVASSNAAYQGLRFPGYVNNLPTDVLNTNFQNY
QLRSDYYIQDASFVRMENISLGYNFGNLFDSSVNLRASATVQNVFVITDYSGVSPEIAPG
VDDATGGGIDNNFYPLPRIFSFGVNFGF