Protein Info for Echvi_2841 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Major Facilitator Superfamily.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 389 to 415 (27 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 400 (382 residues), 102.1 bits, see alignment E=3.1e-33 amino acids 292 to 445 (154 residues), 38.1 bits, see alignment E=9.3e-14 PF13347: MFS_2" amino acids 41 to 416 (376 residues), 54.8 bits, see alignment E=6.1e-19

Best Hits

KEGG orthology group: None (inferred from 64% identity to ppn:Palpr_3016)

Predicted SEED Role

"Predicted maltose transporter MalT" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2L8 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Echvi_2841 Major Facilitator Superfamily. (Echinicola vietnamensis KMM 6221, DSM 17526)
MQAQIEKKKLSFWQIWNMSFGFLGIQMGFALQNANASRILQTFGADVEHLSLFWLVAPIT
GMIIQPIIGHYSDRTWTKLGRRRPYFLAGAVLAAIGLVLMPNASLFVAYLPALWVGAGFL
MIMDASFNVAMEPFRALVADKLPTDQRTLGFAVQTLLIGLGAVIGSWLPYVLTEWFSIPT
TANEGIVPQNVLWAFIIGATILVASILWTVLRTSEYPPDELEKSAHKIDKNAQRGLSSIF
TDFIKMPKTMKQLGLVQFFSWFALFSMWVFSTPALAQHVWGLPSSDRSSLEFNEAGNYVG
VIFGVYNLVSALFAMTLPVIAAKIGRKMTHAICLLIGGTGLISILWVTDPEMKWVLNLSM
IGVGIAWASILAMPYAILAGSIPAKKMGVYMGIFNFFITAPQILNGFIGGWIVRYIYGGQ
AIYALFSAGLFLILAAMLTYFVEDKDDGAIA