Protein Info for Echvi_2833 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: L-serine dehydratase, iron-sulfur-dependent, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR00719: L-serine dehydratase, iron-sulfur-dependent, beta subunit" amino acids 4 to 201 (198 residues), 199.4 bits, see alignment E=2.8e-63 PF03315: SDH_beta" amino acids 6 to 83 (78 residues), 42.4 bits, see alignment E=4.6e-15

Best Hits

Swiss-Prot: 44% identical to SDHAB_BACSU: Probable L-serine dehydratase, beta chain (sdaAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 72% identity to mtt:Ftrac_1031)

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0K7 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Echvi_2833 L-serine dehydratase, iron-sulfur-dependent, beta subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MTRKSSVFDMIGPVMIGPSSSHTAGVVRIARAAIKVLGGIPDDAVITFYNSFARTYEGHG
SDKAIIGGLMDLKTDDARIKQAFELAEARGLTYIFKSVGNASVFHPNTIKLNLTKGDRKV
EVIGESLGGGLINIKSIDGFHAEFSAQEHTLIIKADDVSGAIAFITSILAQEQANIATMS
VSRKGKRDMACHVIEMDSGLNAITIKYLESISWIHELIYIPDIDL