Protein Info for Echvi_2783 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: signal peptide peptidase SppA, 67K type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 6 to 544 (539 residues), 455.3 bits, see alignment E=2.9e-140 PF01343: Peptidase_S49" amino acids 124 to 275 (152 residues), 91 bits, see alignment E=8.1e-30 amino acids 368 to 519 (152 residues), 166.3 bits, see alignment E=5e-53 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 313 to 515 (203 residues), 216.1 bits, see alignment E=4.2e-68 PF00574: CLP_protease" amino acids 315 to 393 (79 residues), 22.1 bits, see alignment E=1.3e-08

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 48% identity to psn:Pedsa_2104)

Predicted SEED Role

"Protease IV (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0G9 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Echvi_2783 signal peptide peptidase SppA, 67K type (Echinicola vietnamensis KMM 6221, DSM 17526)
MKFLSNVLAVILGLMIFSVISFILFAGLITLSTAEEKVTISDNTVLHINLENIVLVERTS
EDNIDLSSFGPIPAAYKIGLANVKKAIRTAKENNNIKGIYLQAGTVMANPAVLTELRNEL
IDFSESGKFIVSYSELYSEGGYFLSSAASEIYLNPMGGLEFNGLSSEILFFKGMLEKLEI
EPVIFRVGEFKSAVEPFILDQMSDANRLQTESFLGDMNDYMIRQIAESRSLTFDTLKKAN
DQMLVREPQDAADLGLVDGIWYDDQVKDLLREKLGLEADAEITTINISGINKTAKTKNLT
ASNRIAVIVAEGEIVSGKVEGTISSEIFAQEIKKARMDDDIKAIVLRVNSPGGSVLASEV
IWREMNEAKKVKPVIASMSSLAASGGYYISTPADTIVAQPNTITGSIGIFGMWFNAEGLL
NNKLGITTDVAKTGEFSDFMNPTRQLSEVEKNIIQKQIEDGYDTFITRVADGRKMSKEAV
MEVASGRVWSGRQAKENGLVDILGGLDDAIQIAANKADVGEDYRVLYYPKQKTILEQIMT
ELGTDIEARYMNYRFGNSYRLLEKIENIQQMKGINARLPFDIKVK