Protein Info for Echvi_2757 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: N-acyl-D-aspartate/D-glutamate deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07969: Amidohydro_3" amino acids 73 to 503 (431 residues), 67.7 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 52% identity to tsa:AciPR4_0237)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0E2 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Echvi_2757 N-acyl-D-aspartate/D-glutamate deacylase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSNIIGQPWLLLWAIMLMAACTPPVEVDVLITGGWVLDGSHSPARRLDVGVTGERISYV
GVPGERKVIGKAVVDIDGLYLAPGFIDPHTHVERELSDPKQKSNLRYLRQGVTTVFAGND
GSSPMPVKRKLDEWDRNGIGTNAALLVGHGSVRRVVMGMEAKEADAQALKEMEKLVHKSM
EEGAFGISTGLFYAPGSFATMEEVIALSKVVSAHDGIYDTHMRDEGSYNIGLMNAVKETI
AIGEKAGVKVHISHIKCLGTDVWDKSPEVIKLVEDAKKRGVHVTANQYPYLASRTSLKAA
LVPRWAEDGGYEKMVERFDDPGLRDTLVAGITENLRKRGGPESLIFSDAVDETMNGKSLG
DIAKKWEMDLPETTMQVLRQDGGIKVISFNMKESDLERFMQQPWVMTGSDGGAGHPRQFG
TFPRKMHQYVEVEKVIDLPFMVHSSSGLTAETFGVKERGFVKEGYYADLIVFDPEKVKDI
ATFERPYEEAQGMDYVWVNGELIINQGNYTGKLAGKALRK