Protein Info for Echvi_2750 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 298 to 314 (17 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 20 to 344 (325 residues), 103.1 bits, see alignment E=8.1e-34

Best Hits

KEGG orthology group: None (inferred from 56% identity to shg:Sph21_5101)

Predicted SEED Role

"acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2B3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Echvi_2750 Predicted acyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNTIEKKQLLKTKQHFDVLDGLRGLAAVIVVIFHFMEIIIPDFTINVLAHGYLAVDFFF
CLSGFVIAYAYDNRISKIGFITFIKLRLIRLHPLVVLGAVIGLVVFVFDPFVSLVDNYSL
SQNIGMFLSACLMVPYPIVSERYYNIFHLNPPTWSLLWEYVANIIYAGILFKVRQKVLWV
LTGLAAILLVYTVTIYGNLSIGWSGGNFWGGGARILYSFLAGMLVFRSGWIIKSKLGFKG
MSALLMLAFLMPFSETMNVILEPLIVLFYLPFLVALGAGTQPARSERNVCVRSGEISYPL
YMVHYPFIWLFYSYWERFSPSFREQVWIMCVGTPLLIAFAYVITMYLDIPVRKRLKATLR
RKER