Protein Info for Echvi_2744 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Beta-xylosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details PF04616: Glyco_hydro_43" amino acids 122 to 250 (129 residues), 45.2 bits, see alignment E=4e-16

Best Hits

KEGG orthology group: None (inferred from 62% identity to osp:Odosp_0233)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYJ6 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Echvi_2744 Beta-xylosidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLISCFAASIQKRWLYKNIFAYLFLMIGLMVFGQEIVAQEEVRQFREAPAPMYRDPIYDG
AADPVMIWNRQEKSWWMLYTTRRANLPTQDVSAYYGTKIGIAATKDHGQTWVFRGYLDLE
FERGWNTFWAPEIIYHDGKYHMFVSYIQGARNHWGGTSHIHYYTSRNLWDWSHHGPLSLS
SDQIIDATIFRMENGRFRMWYKDDSRGGITMVSESDDLKNWQTKDVPAIGGDAHEGPKVF
QYHGYYWMLTDEWHGMRVYRSDDLMHWIKQGLVLDKPSDREDDTPSGAHGDVLVFGDRAY
AFYFTHPGRTSHSLIKPNNSFHENHRTTIQVAALFFDGETLKDERVEPFDFYLPDGK