Protein Info for Echvi_2704 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type antimicrobial peptide transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details PF00005: ABC_tran" amino acids 50 to 184 (135 residues), 102.3 bits, see alignment E=3.5e-33

Best Hits

Swiss-Prot: 34% identical to LOLD_YERPS: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K02003, (no description) (inferred from 48% identity to dfe:Dfer_3619)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYF3 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Echvi_2704 ABC-type antimicrobial peptide transport system, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MLHKNILSIRFVISAITKVLYMVSLSGVAFSYSKQKTFRFPNFTIDQAPLLILGPSGVGK
TTLLHLIAGFLSPQEGSIRIGEREVSQLKPSQMDRFRGRHIGMVFQQHHFIRSLDLMGNL
QLIQYLAGKSPSPQAIKALLGQLGLGEHLTRNPYAMSQGEQQRAAIAMALINKPSLILAD
EPTSSLDDENCHAVVKLLKDQALAHQADLIIITHDQRLKGEISEAITL