Protein Info for Echvi_2628 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 385 (371 residues), 160.9 bits, see alignment E=4.3e-51 PF02080: TrkA_C" amino acids 416 to 481 (66 residues), 44.2 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 56% identity to cly:Celly_2276)

Predicted SEED Role

"Na(+)/H(+) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1Y1 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Echvi_2628 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MILTAENILLISSILLFAGVIASKTSGKTGIPALLIFLGVGMLAGSDGIGGIVFDDPSMT
QFLGIIALTFILFSGGLDTKWPSVKPILAQGIGLSTIGVLLTSFSLGGFVYWVSDLTLLE
SLLLGSIVSSTDAAAVFSILRSKSIGLKGNLRPLLELESGSNDPMAYFLTIAMTSLITLD
DFSIIEIIPLFFIQMIVGAVLGWLIGRVAVLTINKINLDAEGLYPVLMISLVLLTYTLTD
LLRGNGFLAVYICALTVGNAKILHKKSMMKFFDGVAWLMQVVMFITLGLLVFPSQMLPVI
GLALSAALFLILVARPLGVFLTLIPFRYSFKEKLFLSWVGLRGAVPIVFATFPMIHGVEM
SDVIFHIVFFIVLTSVALQATTLPLAAKLLDLALPEGLKKKSLLDIELSDDVKNALIEVE
IPKEAAIAGNKILEIGFPNSCLIVLIHRNGKFLTPNGETELLEKDILMIMVDDPDQDQLV
KEALGIK