Protein Info for Echvi_2603 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF04480: DUF559" amino acids 12 to 119 (108 residues), 118.6 bits, see alignment E=6.1e-39

Best Hits

Swiss-Prot: 39% identical to Y925_HAEIN: Uncharacterized protein HI_0925 (HI_0925) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 55% identity to ppn:Palpr_0617)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1V8 at UniProt or InterPro

Protein Sequence (122 amino acids)

>Echvi_2603 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDMFFGASAEIKRRAKELRKMLTPVEKVLWEVLRNRQLNELKLRRQHPISRFIVDFYCH
EHQLIVEVDGEVHLDIDQKERDEGRTFELEELGLKVIRFTNKEVYSDLENVLRKIVSTCK
DE