Protein Info for Echvi_2540 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details amino acids 32 to 32 (1 residues), see Phobius details transmembrane" amino acids 29 to 31 (3 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 38 to 111 (74 residues), 47.2 bits, see alignment E=7e-16 PF13715: CarbopepD_reg_2" amino acids 39 to 123 (85 residues), 71.7 bits, see alignment E=1.3e-23 PF07715: Plug" amino acids 133 to 234 (102 residues), 35 bits, see alignment E=5.4e-12 PF00593: TonB_dep_Rec_b-barrel" amino acids 300 to 747 (448 residues), 65.5 bits, see alignment E=2.7e-21 PF25183: OMP_b-brl_4" amino acids 432 to 548 (117 residues), 41.7 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 54% identity to shg:Sph21_4812)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G197 at UniProt or InterPro

Protein Sequence (789 amino acids)

>Echvi_2540 Outer membrane receptor proteins, mostly Fe transport (Echinicola vietnamensis KMM 6221, DSM 17526)
MGKNMRTFLHRGLLRSVLFLGISMCVCSISAFGQVKHTIRGTLEDASTGEGLIGATVFVK
ELETGGTSNVYGFYSLTIPEGDYTVTFSFVGYESVTKTISLDDDMTVDVELEPGSAELEE
VVVSAEPEDENVRSTQMSVNKLDMREVESIPVVFGEKDIVKTIQLLPGIKGNEGGGGFFV
RGGSADQNLILLDEAPVYNASHLLGFFSVFNSDAIKDLSIYKGHIPAEYGGRASSVLDIK
MKEGNTKKFAAQGGIGLISSRATIEAPIVKDKGSFVLSGRRTYVDLFLKLSNNDDINKST
LYFYDLNAKANYKFGDKDRVFVSGYFGRDNFGYAELFGFDWGNATGTIRWNHLFNDRLFL
NSTAVFSDYNYVVDIQGEEEENDGFKVTSSIRDISLKEDFEYYINPDNTLKFGAGLIRHN
FVPGEISPQGDSYINAQTLQNKHAWEAAAYVSEELTISPALSVNGGLRYSWFAQVGPGEV
FTYDQDGDVIAAETYEKGEIVESYGGLEPRLGVTYMLNDETSIKASYGRNRQYLHLVSNS
TSGTPIDLWIPSSNNVRPQIADQIAMGYYRNFKDNTYETSVEVYYKDMQNQVDYRTGAEL
VFNENVESQLLFGKGWSYGAEFFLRKNSGRLTGWVSYTVSKTERKFDGVDYGEVYPASWD
RPHDFSVVGIYQLNKKWNLSASFVYRSGNAVTYPIGKYEMKGEVINMYGKRNNNRMPDYN
RLDVGATMKLKDTEKFSSDLNFSIYNVYARKNAYSISFRENRDDPTKTEAVKIALFSILP
SVTYNFRFK